<?xml version="1.0"?>
<CCTOPItem id="A0A0N4U0E1" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="256" checkSum="c99a1c3c55d9726efb4d91d3f6543ae1">
		<Seq>MSFGFPGRFQRRRESEYDREPRLSKTSVYTCPTVFEPGTGAEFMARSGWN
QRSCYKNGTNTTPITFYGASWSKRILTGTVVILAILLIVFIVTTITLFAL
KVIIINYRHEEISATTPNVLSSQYPRVPSNMLPPPVDLLQSRTFLLDLQV
LSQANSAYDNPSNYEYQRASQMILIAMRNLLKRSTLNYYMRDIIMRNIEN
SGNDLLVRFVLELSVPSGLQINPDIIKNVILSEISQFERQLNGIEVDRKL
VISELF</Seq>
	</Sequence>
	<Topology numTM="1" reliability="59.4928">
		<Region from="1" to="75" loc="I"/>
		<Region from="76" to="100" loc="M"/>
		<Region from="101" to="256" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="77" loc="I"/>
			<Region from="78" to="105" loc="M"/>
			<Region from="106" to="256" loc="O"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="75" loc="O"/>
			<Region from="76" to="104" loc="M"/>
			<Region from="105" to="256" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="77" loc="O"/>
			<Region from="78" to="98" loc="M"/>
			<Region from="99" to="256" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="75" loc="I"/>
			<Region from="76" to="100" loc="M"/>
			<Region from="101" to="256" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="74" loc="O"/>
			<Region from="75" to="100" loc="M"/>
			<Region from="101" to="256" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="74" loc="I"/>
			<Region from="75" to="95" loc="M"/>
			<Region from="96" to="256" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="74" loc="I"/>
			<Region from="75" to="96" loc="M"/>
			<Region from="97" to="256" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="79" loc="I"/>
			<Region from="80" to="100" loc="M"/>
			<Region from="101" to="256" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="79" loc="I"/>
			<Region from="80" to="99" loc="M"/>
			<Region from="100" to="256" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="77" loc="O"/>
			<Region from="78" to="100" loc="M"/>
			<Region from="101" to="256" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
