<?xml version="1.0"?>
<CCTOPItem id="Q32LS6" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Protein ABHD13 {ECO:0000305}</Name>
	<CrossRef>
		<UniProt id="ABHDD_DANRE">
			<AC>Q32LS6</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="337" checkSum="caba4b9e4f39be7b2bda811b0fddb532">
		<Seq>MEKPWRLWGPLEACLLSVCAWSWGFCRVSLLALILTFHLYGGFVLLGLIL
ASLAGILYKFQDVLLYFPDQPSSSRLYVPMPTGIPHENVYIRTKDGIRLN
LILLRYTGENPAGAPTILYFHGNAGNIGHRVPNALLMLVNLKANVVLVDY
RGYGKSEGDPSEDGLYQDAEATLDYVMTRPDIDKTKVVLFGRSLGGAVAI
RLASCNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPLWCYKNKFLSY
RHVVPCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHND
TWQCQGYFSALEQFMKELLKSHAREETTQGTASVTII</Seq>
	</Sequence>
	<Topology numTM="2" reliability="69.7919">
		<Region from="1" to="13" loc="I"/>
		<Region from="14" to="34" loc="M"/>
		<Region from="35" to="36" loc="O"/>
		<Region from="37" to="57" loc="M"/>
		<Region from="58" to="337" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="14" loc="I"/>
			<Region from="15" to="36" loc="M"/>
			<Region from="37" to="38" loc="O"/>
			<Region from="39" to="58" loc="M"/>
			<Region from="59" to="337" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="41" loc="O"/>
			<Region from="42" to="61" loc="M"/>
			<Region from="62" to="337" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="32" loc="I"/>
			<Region from="33" to="53" loc="M"/>
			<Region from="54" to="337" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="31" loc="M"/>
			<Region from="32" to="35" loc="O"/>
			<Region from="36" to="58" loc="M"/>
			<Region from="59" to="187" loc="I"/>
			<Region from="188" to="205" loc="M"/>
			<Region from="206" to="219" loc="O"/>
			<Region from="220" to="238" loc="M"/>
			<Region from="239" to="337" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="24" loc="M"/>
			<Region from="25" to="29" loc="O"/>
			<Region from="30" to="58" loc="M"/>
			<Region from="59" to="337" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="36" loc="O"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="337" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="11" loc="I"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="36" loc="O"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="337" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="14" loc="I"/>
			<Region from="15" to="35" loc="M"/>
			<Region from="36" to="36" loc="O"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="184" loc="I"/>
			<Region from="185" to="205" loc="M"/>
			<Region from="206" to="217" loc="O"/>
			<Region from="218" to="238" loc="M"/>
			<Region from="239" to="337" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="13" loc="I"/>
			<Region from="14" to="33" loc="M"/>
			<Region from="34" to="36" loc="O"/>
			<Region from="37" to="56" loc="M"/>
			<Region from="57" to="186" loc="I"/>
			<Region from="187" to="206" loc="M"/>
			<Region from="207" to="337" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="27" loc="I"/>
			<Region from="28" to="50" loc="M"/>
			<Region from="51" to="337" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
