<?xml version="1.0"?>
<CCTOPItem id="A0A0U5KKP6" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="66" checkSum="cb4015459887a8c173d4c4943d43ef2e">
		<Seq>MNTIVRYYLIILFIITTIEIQNIRSAFKKRPPASFVILENMTSTDRFRKL
LYHCFTSFSTWMVLLG</Seq>
	</Sequence>
	<Topology numTM="1" reliability="84.7594">
		<Region from="1" to="3" loc="O"/>
		<Region from="4" to="23" loc="M"/>
		<Region from="24" to="66" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="3" loc="O"/>
			<Region from="4" to="19" loc="M"/>
			<Region from="20" to="49" loc="I"/>
			<Region from="50" to="65" loc="M"/>
			<Region from="66" to="66" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="2" loc="O"/>
			<Region from="3" to="23" loc="M"/>
			<Region from="24" to="44" loc="I"/>
			<Region from="45" to="65" loc="M"/>
			<Region from="66" to="66" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="25" loc="M"/>
			<Region from="26" to="49" loc="I"/>
			<Region from="50" to="65" loc="M"/>
			<Region from="66" to="66" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="23" loc="M"/>
			<Region from="24" to="66" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="2" loc="O"/>
			<Region from="3" to="23" loc="M"/>
			<Region from="24" to="66" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="2" loc="O"/>
			<Region from="3" to="23" loc="M"/>
			<Region from="24" to="66" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="2" loc="O"/>
			<Region from="3" to="23" loc="M"/>
			<Region from="24" to="66" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="2" loc="O"/>
			<Region from="3" to="22" loc="M"/>
			<Region from="23" to="66" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="3" loc="O"/>
			<Region from="4" to="23" loc="M"/>
			<Region from="24" to="66" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
