<?xml version="1.0"?>
<CCTOPItem id="A0A077YUR3" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="139" checkSum="d11216e4aefea98e27b15e744a0d0bb0">
		<Seq>MCTAPYKKQIITVVFRRYSPIPDGLEFHPGHRYYLISTSEGRMNGVQNRN
GGLCLSKNMRVEFDVRDKNPVPQSDMTQLVNDVAFLRRHMRLKNASKMQN
SLKNLNVDPTPVCSHTAGMERLVINTGALLALFLPFYWF</Seq>
	</Sequence>
	<Topology numTM="1" reliability="80.1218">
		<Region from="1" to="121" loc="I"/>
		<Region from="122" to="138" loc="M"/>
		<Region from="139" to="139" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="122" loc="O"/>
			<Region from="123" to="138" loc="M"/>
			<Region from="139" to="139" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="117" loc="I"/>
			<Region from="118" to="138" loc="M"/>
			<Region from="139" to="139" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="120" loc="I"/>
			<Region from="121" to="138" loc="M"/>
			<Region from="139" to="139" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="121" loc="I"/>
			<Region from="122" to="138" loc="M"/>
			<Region from="139" to="139" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="115" loc="I"/>
			<Region from="116" to="137" loc="M"/>
			<Region from="138" to="139" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="117" loc="I"/>
			<Region from="118" to="138" loc="M"/>
			<Region from="139" to="139" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="120" loc="I"/>
			<Region from="121" to="138" loc="M"/>
			<Region from="139" to="139" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
