<?xml version="1.0"?>
<CCTOPItem id="A0A183XE64" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="156" checkSum="d2a409c6b89f9d451a0877d17cf62b57">
		<Seq>MNRWEAYQYSPTAVVQNQVTMQDSKALVEREVFQHATVGNFLGSSIEGSG
SGFIRCVYTAKNTINATVTLLCDVNAGCCERGCCPQDLFWMAGVFILLVF
VLLVFFIGACIVICCYWRSKREQRREAYEYSIYGSQVGMYPDGCNSYTSR
SVYQRY</Seq>
	</Sequence>
	<Topology numTM="1" reliability="89.1927">
		<Region from="1" to="93" loc="O"/>
		<Region from="94" to="116" loc="M"/>
		<Region from="117" to="156" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="90" loc="O"/>
			<Region from="91" to="116" loc="M"/>
			<Region from="117" to="156" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="87" loc="I"/>
			<Region from="88" to="116" loc="M"/>
			<Region from="117" to="156" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="90" loc="O"/>
			<Region from="91" to="111" loc="M"/>
			<Region from="112" to="156" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="94" loc="O"/>
			<Region from="95" to="117" loc="M"/>
			<Region from="118" to="156" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="87" loc="O"/>
			<Region from="88" to="117" loc="M"/>
			<Region from="118" to="156" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="94" loc="O"/>
			<Region from="95" to="115" loc="M"/>
			<Region from="116" to="156" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="93" loc="O"/>
			<Region from="94" to="115" loc="M"/>
			<Region from="116" to="156" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="93" loc="O"/>
			<Region from="94" to="114" loc="M"/>
			<Region from="115" to="156" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="93" loc="O"/>
			<Region from="94" to="113" loc="M"/>
			<Region from="114" to="156" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="94" loc="O"/>
			<Region from="95" to="117" loc="M"/>
			<Region from="118" to="156" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
