<?xml version="1.0"?>
<CCTOPItem id="A0A146MHV0" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="91" checkSum="d9db1fde2bc929a6b5e8bc76f0fbb430">
		<Seq>MGEDLKSEDILGFKLDRCISDTLIKTGAGLFGGIIFSVVLAKRRPWPLIF
GTGFGLGMGISNCNNDFKQPLPLVSHRIVSSNQVPEEKKSS</Seq>
	</Sequence>
	<Topology numTM="1" reliability="77.1032">
		<Region from="1" to="25" loc="I"/>
		<Region from="26" to="41" loc="M"/>
		<Region from="42" to="91" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="25" loc="I"/>
			<Region from="26" to="41" loc="M"/>
			<Region from="42" to="47" loc="O"/>
			<Region from="48" to="63" loc="M"/>
			<Region from="64" to="91" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="22" loc="I"/>
			<Region from="23" to="49" loc="M"/>
			<Region from="50" to="91" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="22" loc="I"/>
			<Region from="23" to="43" loc="M"/>
			<Region from="44" to="91" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="91" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="22" loc="O"/>
			<Region from="23" to="41" loc="M"/>
			<Region from="42" to="91" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="91" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="20" loc="I"/>
			<Region from="21" to="41" loc="M"/>
			<Region from="42" to="91" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="25" loc="I"/>
			<Region from="26" to="46" loc="M"/>
			<Region from="47" to="91" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="25" loc="I"/>
			<Region from="26" to="45" loc="M"/>
			<Region from="46" to="91" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
