<?xml version="1.0"?>
<CCTOPItem id="A0A077YVH8" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="281" checkSum="da5cee5d4ee1cdd39e46371163f9edc8">
		<Seq>MATFADLASSLAVTLSICSILATFVTIPIIFQRGYNLQQNLGAELDAFKV
LSDDALSELSVIYNVAGRRKARQADSGLCECHSDDTCPPGPPGPPGQPGQ
DGAPGIQGSRGDKGLPGLVPEIEPRETESCRVCLPGEKGFVGQNGMRGPP
GPKGLPGPPGLDGKQGLDGPEGPPGLPGSAGMPGEPGEPGDPGADGVLGS
KGESGPQGPPGTNGVPGPSGVPGSPGKNGAPGEPGLLGELGPPGEQGGVG
VSGPPGPPGSPGRDAQYCACPQRTSVRAKKF</Seq>
	</Sequence>
	<Topology numTM="1" reliability="71.3212">
		<Region from="1" to="10" loc="O"/>
		<Region from="11" to="31" loc="M"/>
		<Region from="32" to="281" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="38" loc="M"/>
			<Region from="39" to="281" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="31" loc="O"/>
			<Region from="32" to="47" loc="M"/>
			<Region from="48" to="281" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="32" loc="M"/>
			<Region from="33" to="281" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="9" loc="I"/>
			<Region from="10" to="30" loc="M"/>
			<Region from="31" to="281" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="11" loc="O"/>
			<Region from="12" to="31" loc="M"/>
			<Region from="32" to="281" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="31" loc="M"/>
			<Region from="32" to="281" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="96" loc="I"/>
			<Region from="97" to="117" loc="M"/>
			<Region from="118" to="127" loc="O"/>
			<Region from="128" to="148" loc="M"/>
			<Region from="149" to="159" loc="I"/>
			<Region from="160" to="180" loc="M"/>
			<Region from="181" to="190" loc="O"/>
			<Region from="191" to="211" loc="M"/>
			<Region from="212" to="222" loc="I"/>
			<Region from="223" to="243" loc="M"/>
			<Region from="244" to="253" loc="O"/>
			<Region from="254" to="274" loc="M"/>
			<Region from="275" to="281" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="10" loc="I"/>
			<Region from="11" to="31" loc="M"/>
			<Region from="32" to="281" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="30" loc="M"/>
			<Region from="31" to="281" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="281" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
