<?xml version="1.0"?>
<CCTOPItem id="A0A183XD99" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="209" checkSum="dc08cc45f436416108283b4316cbc708">
		<Seq>MLEFKNPFGNPFRVERTEAKEKRVGEFSYIPSAYCQLMDEMIGRRTRPWN
AGRIPIKPLQTFTLPEMTREELIFARLMENCACKSTIAAIAGFGLGIVFG
LFTASVDPHATMAFGADPTKIPTLKEMWLESKLRMRSYGKNFASIGFLFT
GTECLVETYRACNDWKNGTLAGAIVGGLIGLRAGVKPAALGAAGFAAFST
VIDYYMKYR</Seq>
	</Sequence>
	<Topology numTM="2" reliability="88.6273">
		<Region from="1" to="85" loc="I"/>
		<Region from="86" to="106" loc="M"/>
		<Region from="107" to="182" loc="O"/>
		<Region from="183" to="202" loc="M"/>
		<Region from="203" to="209" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="84" loc="I"/>
			<Region from="85" to="106" loc="M"/>
			<Region from="107" to="182" loc="O"/>
			<Region from="183" to="202" loc="M"/>
			<Region from="203" to="209" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="83" loc="O"/>
			<Region from="84" to="103" loc="M"/>
			<Region from="104" to="188" loc="I"/>
			<Region from="189" to="205" loc="M"/>
			<Region from="206" to="209" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="184" loc="O"/>
			<Region from="185" to="205" loc="M"/>
			<Region from="206" to="209" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="84" loc="I"/>
			<Region from="85" to="105" loc="M"/>
			<Region from="106" to="182" loc="O"/>
			<Region from="183" to="206" loc="M"/>
			<Region from="207" to="209" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="187" loc="O"/>
			<Region from="188" to="206" loc="M"/>
			<Region from="207" to="209" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="185" loc="O"/>
			<Region from="186" to="206" loc="M"/>
			<Region from="207" to="209" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="81" loc="I"/>
			<Region from="82" to="102" loc="M"/>
			<Region from="103" to="180" loc="O"/>
			<Region from="181" to="201" loc="M"/>
			<Region from="202" to="209" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="106" loc="M"/>
			<Region from="107" to="164" loc="O"/>
			<Region from="165" to="185" loc="M"/>
			<Region from="186" to="209" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="85" loc="I"/>
			<Region from="86" to="105" loc="M"/>
			<Region from="106" to="185" loc="O"/>
			<Region from="186" to="205" loc="M"/>
			<Region from="206" to="209" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="86" loc="I"/>
			<Region from="87" to="106" loc="M"/>
			<Region from="107" to="178" loc="O"/>
			<Region from="179" to="201" loc="M"/>
			<Region from="202" to="209" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
