<?xml version="1.0"?>
<CCTOPItem id="Q8IVY1" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Type III endosome membrane protein TEMP {ECO:0000250|UniProtKB:Q9CQM1}</Name>
	<CrossRef>
		<UniProt id="CA210_HUMAN">
			<AC>Q8IVY1</AC>
			<AC>D3DPX2</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="113" checkSum="dcc849d00b20cfbb8ba0c5fe38d6b2a3">
		<Seq>MNETNKTLVGPSELPTASAVAPGPGTGARAWPVLVGFVLGAVVLSLLIAL
AAKCHLCRRYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTG
ELGTEGSRDHFSL</Seq>
	</Sequence>
	<Topology numTM="1" reliability="91.6174">
		<Region from="1" to="32" loc="O"/>
		<Region from="33" to="52" loc="M"/>
		<Region from="53" to="113" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="26" loc="M"/>
			<Region from="27" to="32" loc="O"/>
			<Region from="33" to="52" loc="M"/>
			<Region from="53" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="53" loc="M"/>
			<Region from="54" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="32" loc="O"/>
			<Region from="33" to="57" loc="M"/>
			<Region from="58" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="29" loc="O"/>
			<Region from="30" to="52" loc="M"/>
			<Region from="53" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="31" loc="O"/>
			<Region from="32" to="52" loc="M"/>
			<Region from="53" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="30" loc="O"/>
			<Region from="31" to="51" loc="M"/>
			<Region from="52" to="113" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="35" loc="O"/>
			<Region from="36" to="56" loc="M"/>
			<Region from="57" to="113" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="35" loc="O"/>
			<Region from="36" to="55" loc="M"/>
			<Region from="56" to="113" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="29" loc="O"/>
			<Region from="30" to="52" loc="M"/>
			<Region from="53" to="113" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
