<?xml version="1.0"?>
<CCTOPItem id="A0A077YUT0" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="129" checkSum="e050d26a1f45f0578a39fc6d08c9f0a9">
		<Seq>MYIRCFSSIILSGDSSTGGRLPVNHVQFSGNGIQSIQVVSNDNVVSVFFL
GLVLRECAYIVASMFNNSENSPTNYAFYDENYSVIFNICLWLVIAFACSL
LYIGVGMWSMDPGRESIVYRMTMTRAKKD</Seq>
	</Sequence>
	<Topology numTM="2" reliability="71.5535">
		<Region from="1" to="43" loc="I"/>
		<Region from="44" to="61" loc="M"/>
		<Region from="62" to="83" loc="O"/>
		<Region from="84" to="106" loc="M"/>
		<Region from="107" to="129" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="83" loc="O"/>
			<Region from="84" to="107" loc="M"/>
			<Region from="108" to="129" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="82" loc="I"/>
			<Region from="83" to="106" loc="M"/>
			<Region from="107" to="129" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="82" loc="I"/>
			<Region from="83" to="103" loc="M"/>
			<Region from="104" to="129" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="43" loc="I"/>
			<Region from="44" to="63" loc="M"/>
			<Region from="64" to="83" loc="O"/>
			<Region from="84" to="106" loc="M"/>
			<Region from="107" to="129" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="43" loc="I"/>
			<Region from="44" to="65" loc="M"/>
			<Region from="66" to="84" loc="O"/>
			<Region from="85" to="105" loc="M"/>
			<Region from="106" to="129" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="84" loc="I"/>
			<Region from="85" to="105" loc="M"/>
			<Region from="106" to="129" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="82" loc="I"/>
			<Region from="83" to="104" loc="M"/>
			<Region from="105" to="129" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="41" loc="I"/>
			<Region from="42" to="62" loc="M"/>
			<Region from="63" to="87" loc="O"/>
			<Region from="88" to="108" loc="M"/>
			<Region from="109" to="129" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="40" loc="I"/>
			<Region from="41" to="60" loc="M"/>
			<Region from="61" to="87" loc="O"/>
			<Region from="88" to="107" loc="M"/>
			<Region from="108" to="129" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="43" loc="I"/>
			<Region from="44" to="63" loc="M"/>
			<Region from="64" to="82" loc="O"/>
			<Region from="83" to="105" loc="M"/>
			<Region from="106" to="129" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
