<?xml version="1.0"?>
<CCTOPItem id="Q2A955" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="126" checkSum="e2d1767cd51eb2f624393cafdd5909e0">
		<Seq>MAYIFGFGDGILISFGIILVSIVLCILNGRSKGLSSVITYVIIAALFLAT
LFLWPIKSADEPTPIEQQKTDIVLIPRVVYLIFLPFFMIYLINLFVRHNL
FNVVRTKSTVNRHGKPWLAEAKVKNS</Seq>
	</Sequence>
	<Topology numTM="3" reliability="93.7929">
		<Region from="1" to="6" loc="O"/>
		<Region from="7" to="27" loc="M"/>
		<Region from="28" to="33" loc="I"/>
		<Region from="34" to="54" loc="M"/>
		<Region from="55" to="73" loc="O"/>
		<Region from="74" to="94" loc="M"/>
		<Region from="95" to="126" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="9" loc="O"/>
			<Region from="10" to="27" loc="M"/>
			<Region from="28" to="32" loc="I"/>
			<Region from="33" to="53" loc="M"/>
			<Region from="54" to="77" loc="O"/>
			<Region from="78" to="96" loc="M"/>
			<Region from="97" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="10" loc="O"/>
			<Region from="11" to="27" loc="M"/>
			<Region from="28" to="36" loc="I"/>
			<Region from="37" to="53" loc="M"/>
			<Region from="54" to="73" loc="O"/>
			<Region from="74" to="96" loc="M"/>
			<Region from="97" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="33" loc="I"/>
			<Region from="34" to="54" loc="M"/>
			<Region from="55" to="74" loc="O"/>
			<Region from="75" to="95" loc="M"/>
			<Region from="96" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="35" loc="I"/>
			<Region from="36" to="56" loc="M"/>
			<Region from="57" to="73" loc="O"/>
			<Region from="74" to="96" loc="M"/>
			<Region from="97" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="27" loc="M"/>
			<Region from="28" to="33" loc="I"/>
			<Region from="34" to="54" loc="M"/>
			<Region from="55" to="73" loc="O"/>
			<Region from="74" to="96" loc="M"/>
			<Region from="97" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="34" loc="I"/>
			<Region from="35" to="55" loc="M"/>
			<Region from="56" to="71" loc="O"/>
			<Region from="72" to="92" loc="M"/>
			<Region from="93" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="34" loc="I"/>
			<Region from="35" to="55" loc="M"/>
			<Region from="56" to="72" loc="O"/>
			<Region from="73" to="93" loc="M"/>
			<Region from="94" to="126" loc="I"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="36" loc="I"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="74" loc="O"/>
			<Region from="75" to="95" loc="M"/>
			<Region from="96" to="126" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="6" loc="O"/>
			<Region from="7" to="26" loc="M"/>
			<Region from="27" to="36" loc="I"/>
			<Region from="37" to="56" loc="M"/>
			<Region from="57" to="74" loc="O"/>
			<Region from="75" to="94" loc="M"/>
			<Region from="95" to="126" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="27" loc="M"/>
			<Region from="28" to="33" loc="I"/>
			<Region from="34" to="56" loc="M"/>
			<Region from="57" to="73" loc="O"/>
			<Region from="74" to="96" loc="M"/>
			<Region from="97" to="126" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
