<?xml version="1.0"?>
<CCTOPItem id="Q10462" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Putative carbonic anhydrase 5</Name>
	<CrossRef>
		<UniProt id="CAH5_CAEEL">
			<AC>Q10462</AC>
		</UniProt>
		<Signal id="SignalP">
			<Results>1-21</Results>
			<Parameters>0.9998</Parameters>
		</Signal>
	</CrossRef>
	<Sequence length="310" checkSum="e9d1d8a4ba03f94a9a0bd793bae8e3f9">
		<Signal from="1" to="21"/>
		<Seq>MPSHLLVLSLLVALLVVVSCGPGSDHGWGYDENNGPDTWQGKCQNHLKQS
PIDIRAPDVDYALLHRMHFLNYDMDGKIELSNTGRTLFAGGFESWQHKQP
MIQGGGLKHRYKLAQFHLHWGQNDAVGSEHAMGSLHYPAELHLVHVREGL
TLKEALSRPDGLAVVGVFLAKTNDPVANKFSPISERLHDLRHSGNKTELK
NFRTKYVLPLDTEAFYRYEGSLTTPDCSEAVIWTVLAEPMAISSHQLHLL
RQLHNKELVKSDKNYRPLQPLNGRRIQYRPSKLDRAMICSSFATTSVIIT
YVAILSAMLI</Seq>
	</Sequence>
	<Topology numTM="1" reliability="85.6202">
		<Region from="1" to="21" loc="S"/>
		<Region from="22" to="287" loc="O"/>
		<Region from="288" to="309" loc="M"/>
		<Region from="310" to="310" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="22" to="287" loc="O"/>
			<Region from="288" to="309" loc="M"/>
			<Region from="310" to="310" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="22" to="288" loc="I"/>
			<Region from="289" to="307" loc="M"/>
			<Region from="308" to="310" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="22" to="288" loc="I"/>
			<Region from="289" to="309" loc="M"/>
			<Region from="310" to="310" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="22" to="285" loc="I"/>
			<Region from="286" to="305" loc="M"/>
			<Region from="306" to="310" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="22" to="285" loc="I"/>
			<Region from="286" to="309" loc="M"/>
			<Region from="310" to="310" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="22" to="287" loc="I"/>
			<Region from="288" to="308" loc="M"/>
			<Region from="309" to="310" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="22" to="286" loc="I"/>
			<Region from="287" to="307" loc="M"/>
			<Region from="308" to="310" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="22" to="285" loc="I"/>
			<Region from="286" to="306" loc="M"/>
			<Region from="307" to="310" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="22" to="285" loc="I"/>
			<Region from="286" to="305" loc="M"/>
			<Region from="306" to="310" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="22" to="286" loc="I"/>
			<Region from="287" to="309" loc="M"/>
			<Region from="310" to="310" loc="O"/>
		</Prediction>
	</Predictions>
	<Constraints>
		<Constraint source="SIGNAL" sourceId="SignalP">
			<ConstraintRegion from="22" to="22" loc="O"/>
		</Constraint>
	</Constraints>
</CCTOPItem>
