<?xml version="1.0"?>
<CCTOPItem id="P12114" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Cuticle collagen sqt-1</Name>
	<CrossRef>
		<UniProt id="SQT1_CAEEL">
			<AC>P12114</AC>
			<AC>Q17509</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="324" checkSum="ef9780bef00d804b119dbaeb05ea3601">
		<Seq>MSVKLACYVTASVTVATLMVCFMTMSTIYSEVDGFREKLDTEMNVFRQST
NGLWKDIVVIGRSSKRVRRQYEETNATPTPHADGSPSAPPGQPPAVPPVF
NQPKTPNGANGNGPTCNCNADNKCPAGPSGPKGVPGVPGLDGVPGLDGVP
GVGADDIAPQRESVGCFTCPQGPVGPPGALGRPGPRGLPGPRGQNGNPGR
DGQPGHPGEQGSSGQIGKIGEPGPPGEKGRDAEHPIGRPGPKGPRGDQGP
TGPAGQNGLHGPPGEPGTVGPEGPSGKQGRQGPDGTQGETGPDGRPGKDA
EYCQCPDKSPPSEAVNANRGYRNI</Seq>
	</Sequence>
	<Topology numTM="1" reliability="73.9842">
		<Region from="1" to="8" loc="O"/>
		<Region from="9" to="28" loc="M"/>
		<Region from="29" to="324" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="28" loc="M"/>
			<Region from="29" to="324" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="23" loc="O"/>
			<Region from="24" to="39" loc="M"/>
			<Region from="40" to="324" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="8" loc="O"/>
			<Region from="9" to="29" loc="M"/>
			<Region from="30" to="324" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="324" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="94" loc="O"/>
			<Region from="95" to="115" loc="M"/>
			<Region from="116" to="124" loc="I"/>
			<Region from="125" to="145" loc="M"/>
			<Region from="146" to="149" loc="O"/>
			<Region from="150" to="170" loc="M"/>
			<Region from="171" to="179" loc="I"/>
			<Region from="180" to="200" loc="M"/>
			<Region from="201" to="204" loc="O"/>
			<Region from="205" to="225" loc="M"/>
			<Region from="226" to="234" loc="I"/>
			<Region from="235" to="255" loc="M"/>
			<Region from="256" to="259" loc="O"/>
			<Region from="260" to="280" loc="M"/>
			<Region from="281" to="289" loc="I"/>
			<Region from="290" to="310" loc="M"/>
			<Region from="311" to="324" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="324" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="8" loc="O"/>
			<Region from="9" to="28" loc="M"/>
			<Region from="29" to="324" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="29" loc="M"/>
			<Region from="30" to="324" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
