<?xml version="1.0"?>
<CCTOPItem id="A0A0K0DS16" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Sequence length="420" checkSum="f235100e7a1b4e837488eeb3e452b3a9">
		<Seq>MNGSVNESLNELPDLPFIGEYEVEIDVPYNQISSDAFINALSIKLKKKCL
EIKKFLNKNSDCLHLHIEQLRKFASSPGGLILDEYREKIWPVLAKYYPSD
LEYVKNSDEYESDSDYDTVSSTFNAEYDDEYIEPTIEMLQLHKDWKQVQL
DVHRTLERFPPFIDEENRTKLMNELTPFIVRILSRNKKFHYYQGFHDVCL
TIVLAVGLDIGYQICKSLTRKGVFSLYLKKTLEESVLKELELMFPIFYKK
SKIIDRALKDSNMTCIFALSWPLTWLSHSLHKYQHIVLCFDLFLSSHSLM
PIYLSSALILSREEEIRVCENDMGLLYGVLNKIPENCRIPEIIIKAQNLF
DDYPPLVLRKRLMNEYLEDRKAPIPRPKKPISRNSIFDNLHVLGFVGFGS
ALLLYFVYQYYSSILSGYSI</Seq>
	</Sequence>
	<Topology numTM="1" reliability="60.795">
		<Region from="1" to="389" loc="I"/>
		<Region from="390" to="408" loc="M"/>
		<Region from="409" to="420" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="197" loc="O"/>
			<Region from="198" to="215" loc="M"/>
			<Region from="216" to="260" loc="I"/>
			<Region from="261" to="276" loc="M"/>
			<Region from="277" to="391" loc="O"/>
			<Region from="392" to="407" loc="M"/>
			<Region from="408" to="420" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="195" loc="O"/>
			<Region from="196" to="211" loc="M"/>
			<Region from="212" to="263" loc="I"/>
			<Region from="264" to="280" loc="M"/>
			<Region from="281" to="283" loc="O"/>
			<Region from="284" to="306" loc="M"/>
			<Region from="307" to="390" loc="I"/>
			<Region from="391" to="411" loc="M"/>
			<Region from="412" to="420" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="388" loc="I"/>
			<Region from="389" to="409" loc="M"/>
			<Region from="410" to="420" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="260" loc="I"/>
			<Region from="261" to="275" loc="M"/>
			<Region from="276" to="285" loc="O"/>
			<Region from="286" to="304" loc="M"/>
			<Region from="305" to="386" loc="I"/>
			<Region from="387" to="408" loc="M"/>
			<Region from="409" to="420" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="385" loc="I"/>
			<Region from="386" to="408" loc="M"/>
			<Region from="409" to="420" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="389" loc="I"/>
			<Region from="390" to="410" loc="M"/>
			<Region from="411" to="420" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="262" loc="I"/>
			<Region from="263" to="283" loc="M"/>
			<Region from="284" to="287" loc="O"/>
			<Region from="288" to="308" loc="M"/>
			<Region from="309" to="389" loc="I"/>
			<Region from="390" to="410" loc="M"/>
			<Region from="411" to="420" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="194" loc="O"/>
			<Region from="195" to="215" loc="M"/>
			<Region from="216" to="256" loc="I"/>
			<Region from="257" to="277" loc="M"/>
			<Region from="278" to="289" loc="O"/>
			<Region from="290" to="310" loc="M"/>
			<Region from="311" to="387" loc="I"/>
			<Region from="388" to="408" loc="M"/>
			<Region from="409" to="420" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="194" loc="O"/>
			<Region from="195" to="214" loc="M"/>
			<Region from="215" to="256" loc="I"/>
			<Region from="257" to="276" loc="M"/>
			<Region from="277" to="291" loc="O"/>
			<Region from="292" to="311" loc="M"/>
			<Region from="312" to="387" loc="I"/>
			<Region from="388" to="407" loc="M"/>
			<Region from="408" to="420" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="385" loc="O"/>
			<Region from="386" to="408" loc="M"/>
			<Region from="409" to="420" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
