<?xml version="1.0"?>
<CCTOPItem id="P56411" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Diacylglycerol kinase {ECO:0000250|UniProtKB:P0ABN1}</Name>
	<CrossRef>
		<UniProt id="KDGL_HELPY">
			<AC>P56411</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="128" checkSum="f650b288631133e36830236670f5ec6d">
		<Seq>MSDFEVPPKAKGFKRLFKALFYSKDGLKCAWIEESAFRQIVILALFCIVL
ASYLAKDFLEWGLLILPCFLSVVVELINSSIEKAVDFTGTEFHPLAKKAK
DMASAAQLIGLIFWTLIWGRYLLALYLK</Seq>
	</Sequence>
	<Topology numTM="3" reliability="83.5087">
		<Region from="1" to="35" loc="I"/>
		<Region from="36" to="56" loc="M"/>
		<Region from="57" to="60" loc="O"/>
		<Region from="61" to="81" loc="M"/>
		<Region from="82" to="102" loc="I"/>
		<Region from="103" to="123" loc="M"/>
		<Region from="124" to="128" loc="O"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="15" loc="I"/>
			<Region from="16" to="32" loc="M"/>
			<Region from="33" to="39" loc="O"/>
			<Region from="40" to="55" loc="M"/>
			<Region from="56" to="57" loc="I"/>
			<Region from="58" to="74" loc="M"/>
			<Region from="75" to="104" loc="O"/>
			<Region from="105" to="127" loc="M"/>
			<Region from="128" to="128" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="41" loc="I"/>
			<Region from="42" to="57" loc="M"/>
			<Region from="58" to="60" loc="O"/>
			<Region from="61" to="78" loc="M"/>
			<Region from="79" to="103" loc="I"/>
			<Region from="104" to="125" loc="M"/>
			<Region from="126" to="128" loc="O"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="36" loc="I"/>
			<Region from="37" to="57" loc="M"/>
			<Region from="58" to="59" loc="O"/>
			<Region from="60" to="80" loc="M"/>
			<Region from="81" to="105" loc="I"/>
			<Region from="106" to="126" loc="M"/>
			<Region from="127" to="128" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="55" loc="M"/>
			<Region from="56" to="62" loc="O"/>
			<Region from="63" to="81" loc="M"/>
			<Region from="82" to="101" loc="I"/>
			<Region from="102" to="124" loc="M"/>
			<Region from="125" to="128" loc="O"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="55" loc="M"/>
			<Region from="56" to="60" loc="O"/>
			<Region from="61" to="81" loc="M"/>
			<Region from="82" to="101" loc="I"/>
			<Region from="102" to="123" loc="M"/>
			<Region from="124" to="128" loc="O"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="56" loc="M"/>
			<Region from="57" to="60" loc="O"/>
			<Region from="61" to="81" loc="M"/>
			<Region from="82" to="101" loc="I"/>
			<Region from="102" to="122" loc="M"/>
			<Region from="123" to="128" loc="O"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="34" loc="I"/>
			<Region from="35" to="55" loc="M"/>
			<Region from="56" to="60" loc="O"/>
			<Region from="61" to="81" loc="M"/>
			<Region from="82" to="101" loc="I"/>
			<Region from="102" to="123" loc="M"/>
			<Region from="124" to="128" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="34" loc="I"/>
			<Region from="35" to="55" loc="M"/>
			<Region from="56" to="56" loc="O"/>
			<Region from="57" to="77" loc="M"/>
			<Region from="78" to="104" loc="I"/>
			<Region from="105" to="125" loc="M"/>
			<Region from="126" to="128" loc="O"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="35" loc="I"/>
			<Region from="36" to="55" loc="M"/>
			<Region from="56" to="57" loc="O"/>
			<Region from="58" to="77" loc="M"/>
			<Region from="78" to="102" loc="I"/>
			<Region from="103" to="122" loc="M"/>
			<Region from="123" to="128" loc="O"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="35" loc="O"/>
			<Region from="36" to="55" loc="M"/>
			<Region from="56" to="61" loc="I"/>
			<Region from="62" to="81" loc="M"/>
			<Region from="82" to="104" loc="O"/>
			<Region from="105" to="127" loc="M"/>
			<Region from="128" to="128" loc="I"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
