<?xml version="1.0"?>
<CCTOPItem id="Q17703" transmembrane="yes" evidence="Prediction">
	<Copyright>Copyrighted by the Institute of Enzymology!</Copyright>
	<Name>Putative steroid dehydrogenase 1</Name>
	<CrossRef>
		<UniProt id="STDH1_CAEEL">
			<AC>Q17703</AC>
		</UniProt>
	</CrossRef>
	<Sequence length="314" checkSum="fe0f4a876024f16f7f68f6d8a849b6de">
		<Seq>MDIEWFATGVGAVVVLYILYHFIRITLNILGPYVFCQPIDLKKKAGASWA
VVTGATDGIGKSYSFELAKRGFNVYIVSRTQSKLEHTKKEILEVHPDIEV
RFATFDFTNPSVSDYEKLLSKLNEVSIGILINNVGMFFDYPEMLHKINGG
IDSIANVTIINTLPATLLSAGILPQMVPRKAGIIVNIGSVAGLATMAEWS
VYSATKKYVEWITGCLQKEYGHQGIIFQAITPAMVATKMAGNPNTSFFTP
DSDTFAKSALNTIGHASQTTGYITHQIECEMLKLLPDFVIDRSIKQTSAQ
LREALAKNENKPLM</Seq>
	</Sequence>
	<Topology numTM="1" reliability="50.7652">
		<Region from="1" to="5" loc="O"/>
		<Region from="6" to="27" loc="M"/>
		<Region from="28" to="314" loc="I"/>
	</Topology>
	<Predictions>
		<Prediction name="HMMTOP">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="27" loc="M"/>
			<Region from="28" to="31" loc="I"/>
			<Region from="32" to="53" loc="M"/>
			<Region from="54" to="156" loc="O"/>
			<Region from="157" to="177" loc="M"/>
			<Region from="178" to="181" loc="I"/>
			<Region from="182" to="202" loc="M"/>
			<Region from="203" to="275" loc="O"/>
			<Region from="276" to="296" loc="M"/>
			<Region from="297" to="314" loc="I"/>
		</Prediction>
		<Prediction name="Memsat">
			<Region from="1" to="274" loc="O"/>
			<Region from="275" to="290" loc="M"/>
			<Region from="291" to="314" loc="I"/>
		</Prediction>
		<Prediction name="Octopus">
			<Region from="1" to="8" loc="O"/>
			<Region from="9" to="29" loc="M"/>
			<Region from="30" to="46" loc="I"/>
			<Region from="47" to="67" loc="M"/>
			<Region from="68" to="314" loc="O"/>
		</Prediction>
		<Prediction name="Philius">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="152" loc="I"/>
			<Region from="153" to="173" loc="M"/>
			<Region from="174" to="181" loc="O"/>
			<Region from="182" to="202" loc="M"/>
			<Region from="203" to="314" loc="I"/>
		</Prediction>
		<Prediction name="Phobius">
			<Region from="1" to="5" loc="O"/>
			<Region from="6" to="23" loc="M"/>
			<Region from="24" to="314" loc="I"/>
		</Prediction>
		<Prediction name="Pro">
			<Region from="1" to="4" loc="O"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="314" loc="I"/>
		</Prediction>
		<Prediction name="Prodiv">
			<Region from="1" to="6" loc="I"/>
			<Region from="7" to="27" loc="M"/>
			<Region from="28" to="43" loc="O"/>
			<Region from="44" to="64" loc="M"/>
			<Region from="65" to="183" loc="I"/>
			<Region from="184" to="204" loc="M"/>
			<Region from="205" to="314" loc="O"/>
		</Prediction>
		<Prediction name="Scampi">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="25" loc="M"/>
			<Region from="26" to="178" loc="O"/>
			<Region from="179" to="199" loc="M"/>
			<Region from="200" to="314" loc="I"/>
		</Prediction>
		<Prediction name="ScampiMsa">
			<Region from="1" to="15" loc="O"/>
			<Region from="16" to="35" loc="M"/>
			<Region from="36" to="314" loc="I"/>
		</Prediction>
		<Prediction name="TMHMM">
			<Region from="1" to="4" loc="I"/>
			<Region from="5" to="27" loc="M"/>
			<Region from="28" to="314" loc="O"/>
		</Prediction>
	</Predictions>
</CCTOPItem>
